Lineage for d5af7b2 (5af7 B:233-393)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708486Species Advenella mimigardefordensis [TaxId:1247726] [273384] (2 PDB entries)
  8. 2708488Domain d5af7b2: 5af7 B:233-393 [273393]
    Other proteins in same PDB: d5af7a1, d5af7b1
    automated match to d1jqia1
    complexed with fad, gol

Details for d5af7b2

PDB Entry: 5af7 (more details), 1.89 Å

PDB Description: 3-sulfinopropionyl-coenzyme a (3sp-coa) desulfinase from advenella mimigardefordensis dpn7t: crystal structure and function of a desulfinase with an acyl-coa dehydrogenase fold. native crystal structure
PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5af7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5af7b2 a.29.3.0 (B:233-393) automated matches {Advenella mimigardefordensis [TaxId: 1247726]}
krgfaalmsaynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadm
svqleaarlmlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpm
erhvrdarmftiaggtaqilrtqvaskildmklpqtrdgyl

SCOPe Domain Coordinates for d5af7b2:

Click to download the PDB-style file with coordinates for d5af7b2.
(The format of our PDB-style files is described here.)

Timeline for d5af7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5af7b1