| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
| Protein automated matches [226935] (30 species) not a true protein |
| Species Advenella mimigardefordensis [TaxId:1247726] [273384] (2 PDB entries) |
| Domain d5ahsc2: 5ahs C:233-392 [273390] Other proteins in same PDB: d5ahsa1, d5ahsb1, d5ahsc1, d5ahsd1, d5ahse1, d5ahsf1 automated match to d1jqia1 complexed with coa, fad, sin, so4 |
PDB Entry: 5ahs (more details), 2.3 Å
SCOPe Domain Sequences for d5ahsc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ahsc2 a.29.3.0 (C:233-392) automated matches {Advenella mimigardefordensis [TaxId: 1247726]}
krgfaalmsaynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadm
svqleaarlmlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpm
erhvrdarmftiaggtaqilrtqvaskildmklpqtrdgy
Timeline for d5ahsc2: