Lineage for d5ahsc1 (5ahs C:2-232)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015629Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 3015630Protein automated matches [226934] (29 species)
    not a true protein
  7. 3015637Species Advenella mimigardefordensis [TaxId:1247726] [273374] (2 PDB entries)
  8. 3015642Domain d5ahsc1: 5ahs C:2-232 [273382]
    Other proteins in same PDB: d5ahsa2, d5ahsb2, d5ahsc2, d5ahsd2, d5ahse2, d5ahsf2
    automated match to d1jqia2
    complexed with coa, fad, sin, so4

Details for d5ahsc1

PDB Entry: 5ahs (more details), 2.3 Å

PDB Description: 3-sulfinopropionyl-coenzyme a (3sp-coa) desulfinase from advenella mimgardefordensis dpn7t: holo crystal structure with the substrate analog succinyl-coa
PDB Compounds: (C:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5ahsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ahsc1 e.6.1.0 (C:2-232) automated matches {Advenella mimigardefordensis [TaxId: 1247726]}
yeltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvggr
glstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpai
cisepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgiga
fitvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdgl

SCOPe Domain Coordinates for d5ahsc1:

Click to download the PDB-style file with coordinates for d5ahsc1.
(The format of our PDB-style files is described here.)

Timeline for d5ahsc1: