Class b: All beta proteins [48724] (165 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) |
Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins) |
Protein Streptavidin [50878] (1 species) |
Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries) |
Domain d1vwfb_: 1vwf B: [27337] complexed with ace, nh2 |
PDB Entry: 1vwf (more details), 1.92 Å
SCOP Domain Sequences for d1vwfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vwfb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]} aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk v
Timeline for d1vwfb_: