Lineage for d1vwfb_ (1vwf B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674116Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 674117Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 674118Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 674147Protein Streptavidin [50878] (1 species)
  7. 674148Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries)
  8. 674324Domain d1vwfb_: 1vwf B: [27337]
    complexed with ace, nh2

Details for d1vwfb_

PDB Entry: 1vwf (more details), 1.92 Å

PDB Description: streptavidin complexed with cyclo-ac-[chpqgppc]-nh2 monomer, ph 3.67
PDB Compounds: (B:) streptavidin

SCOP Domain Sequences for d1vwfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vwfb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

SCOP Domain Coordinates for d1vwfb_:

Click to download the PDB-style file with coordinates for d1vwfb_.
(The format of our PDB-style files is described here.)

Timeline for d1vwfb_: