Lineage for d4zwlb_ (4zwl B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1875571Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 1875572Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 1875981Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 1875982Protein automated matches [190683] (38 species)
    not a true protein
  7. 1876546Species Staphylococcus aureus [TaxId:93062] [225575] (11 PDB entries)
  8. 1876587Domain d4zwlb_: 4zwl B: [273364]
    automated match to d4qn2a_
    complexed with nad, so4; mutant

Details for d4zwlb_

PDB Entry: 4zwl (more details), 2.6 Å

PDB Description: 2.60 angstrom resolution crystal structure of betaine aldehyde dehydrogenase (betb) h448f/y450l double mutant from staphylococcus aureus in complex with nad+ and bme-free cys289
PDB Compounds: (B:) Betaine-aldehyde dehydrogenase

SCOPe Domain Sequences for d4zwlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zwlb_ c.82.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93062]}
fqgmellkhlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerailaarr
afesgewsqetaetrgkkvraiadkikehrealarletldtgktleesyadmddihnvfm
yfagladkdggemidspipdteskivkepvgvvtqitpwnypllqaswkiapalatgcsl
vmkpseitplttirvfelmeevgfpkgtinlilgagsevgdvmsghkevdlvsftggiet
gkhimknaannvtnialelggknpniifddadfelavdqalnggyfhagqvcsagsrilv
qnsikdkfeqalidrvkkiklgngfdadtemgpvistehrnkiesymdvakaegatiavg
gkrpdrddlkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqlandsiyg
lagavfskdigkaqrvanklklgtvwindffplfaqapwggykqsgigrelgkegleeyl
vskhiltntnpqlvnwfsk

SCOPe Domain Coordinates for d4zwlb_:

Click to download the PDB-style file with coordinates for d4zwlb_.
(The format of our PDB-style files is described here.)

Timeline for d4zwlb_: