SCOPe 2.06: Domain d4zwlg_: 4zwl G:

Lineage for d4zwlg_ (4zwl G:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (49 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [225575] (13 PDB entries)

8. Domain d4zwlg_: 4zwl G: [273362]
   Other proteins in same PDB: d4zwla2, d4zwlb2, d4zwlc2, d4zwld2
   automated match to d4qn2a_
   complexed with nad, so4; mutant

Details for d4zwlg_

PDB Entry: 4zwl, 2.6 Å

PDB Description: 2.60 angstrom resolution crystal structure of betaine aldehyde dehydrogenase (betb) h448f/y450l double mutant from staphylococcus aureus in complex with nad+ and bme-free cys289

PDB Compounds: (G:) Betaine-aldehyde dehydrogenase

SCOPe Domain Sequences for d4zwlg_:

Sequence; same for both SEQRES and ATOM records:

>d4zwlg_ c.82.1.0 (G:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mellkhlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerailaarrafe
sgewsqetaetrgkkvraiadkikehrealarletldtgktleesyadmddihnvfmyfa
gladkdggemidspipdteskivkepvgvvtqitpwnypllqaswkiapalatgcslvmk
pseitplttirvfelmeevgfpkgtinlilgagsevgdvmsghkevdlvsftggietgkh
imknaannvtnialelggknpniifddadfelavdqalnggyfhagqvcsagsrilvqns
ikdkfeqalidrvkkiklgngfdadtemgpvistehrnkiesymdvakaegatiavggkr
pdrddlkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqlandsiyglag
avfskdigkaqrvanklklgtvwindffplfaqapwggykqsgigrelgkegleeylvsk
hiltntnpqlvnwfsk

Timeline for d4zwlg_:

• d4zwlg_ first appeared in SCOPe 2.05
  
• d4zwlg_ appears in SCOPe 2.07
  
• d4zwlg_ appears in the current release, SCOPe 2.08