Lineage for d4zrbf1 (4zrb F:1-125)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944632Species Streptococcus pneumoniae [TaxId:170187] [226558] (5 PDB entries)
  8. 2944643Domain d4zrbf1: 4zrb F:1-125 [273355]
    Other proteins in same PDB: d4zrbe2, d4zrbf2, d4zrbg2
    automated match to d3lbea_
    complexed with coa

Details for d4zrbf1

PDB Entry: 4zrb (more details), 2.2 Å

PDB Description: crystal structure of hypothetical thioesterase protein sp_1851 with coenzyme a from streptococcus pneumoniae tigr4
PDB Compounds: (F:) Hypothetical Thioesterase Protein SP_1851

SCOPe Domain Sequences for d4zrbf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zrbf1 d.38.1.0 (F:1-125) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
mkdfhfdaisafenyeiekmrdghvvvttkvvnsslnyygnahggylftlcdqisglvvi
slgldgvtlqssinylkagklddvltikgecvhqgrttcvmdvditnqegrnvckatftm
fvtgq

SCOPe Domain Coordinates for d4zrbf1:

Click to download the PDB-style file with coordinates for d4zrbf1.
(The format of our PDB-style files is described here.)

Timeline for d4zrbf1: