Lineage for d4zrbb_ (4zrb B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1902478Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 1902479Protein automated matches [190143] (32 species)
    not a true protein
  7. 1902683Species Streptococcus pneumoniae [TaxId:170187] [226558] (5 PDB entries)
  8. 1902690Domain d4zrbb_: 4zrb B: [273353]
    automated match to d3lbea_
    complexed with coa

Details for d4zrbb_

PDB Entry: 4zrb (more details), 2.2 Å

PDB Description: crystal structure of hypothetical thioesterase protein sp_1851 with coenzyme a from streptococcus pneumoniae tigr4
PDB Compounds: (B:) Hypothetical Thioesterase Protein SP_1851

SCOPe Domain Sequences for d4zrbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zrbb_ d.38.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
fhfdaisafenyeiekmrdghvvvttkvvnsslnyygnahggylftlcdqisglvvislg
ldgvtlqssinylkagklddvltikgecvhqgrttcvmdvditnqegrnvckatftmfvt
gqr

SCOPe Domain Coordinates for d4zrbb_:

Click to download the PDB-style file with coordinates for d4zrbb_.
(The format of our PDB-style files is described here.)

Timeline for d4zrbb_: