Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (36 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:170187] [226558] (5 PDB entries) |
Domain d4zrbh_: 4zrb H: [273352] Other proteins in same PDB: d4zrbe2, d4zrbf2, d4zrbg2 automated match to d3lbea_ complexed with coa |
PDB Entry: 4zrb (more details), 2.2 Å
SCOPe Domain Sequences for d4zrbh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zrbh_ d.38.1.0 (H:) automated matches {Streptococcus pneumoniae [TaxId: 170187]} mkdfhfdaisafenyeiekmrdghvvvttkvvnsslnyygnahggylftlcdqisglvvi slgldgvtlqssinylkagklddvltikgecvhqgrttcvmdvditnqegrnvckatftm fvtgqr
Timeline for d4zrbh_: