![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
![]() | Protein automated matches [190143] (42 species) not a true protein |
![]() | Species Streptococcus pneumoniae [TaxId:170187] [226558] (5 PDB entries) |
![]() | Domain d4zrbd_: 4zrb D: [273351] Other proteins in same PDB: d4zrbe2, d4zrbf2, d4zrbg2 automated match to d3lbea_ complexed with coa |
PDB Entry: 4zrb (more details), 2.2 Å
SCOPe Domain Sequences for d4zrbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zrbd_ d.38.1.0 (D:) automated matches {Streptococcus pneumoniae [TaxId: 170187]} fhfdaisafenyeiekmrdghvvvttkvvnsslnyygnahggylftlcdqisglvvislg ldgvtlqssinylkagklddvltikgecvhqgrttcvmdvditnqegrnvckatftmfvt gqrs
Timeline for d4zrbd_: