SCOPe 2.08: Domain d4zruh1: 4zru H:1-203

Lineage for d4zruh1 (4zru H:1-203)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)

8. Domain d4zruh1: 4zru H:1-203 [273342]
   Other proteins in same PDB: d4zrua2, d4zrub2, d4zrud2, d4zruf2, d4zrug2, d4zruh2, d4zrui2, d4zruj2
   automated match to d4alxa_
   complexed with po4, ti9

Details for d4zruh1

PDB Entry: 4zru, 1.9 Å

PDB Description: x-ray crystal structure of lymnaea stagnalis acetylcholine binding protein (ls-achbp) in complex with 3-[2-[(2s)-pyrrolidin-2- yl]ethynyl]pyridine (ti-5180)

PDB Compounds: (H:) acetylcholine-binding protein

SCOPe Domain Sequences for d4zruh1:

Sequence, based on SEQRES records:

>d4zruh1 b.96.1.1 (H:1-203) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrk

Sequence, based on observed residues (ATOM records):

>d4zruh1 b.96.1.1 (H:1-203) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrk

Timeline for d4zruh1:

• d4zruh1 first appeared in SCOPe 2.05, called d4zruh_
  
• d4zruh1 appears in SCOPe 2.07