Lineage for d4zglg_ (4zgl G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176031Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2176032Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2176281Family d.13.1.0: automated matches [191614] (1 protein)
    not a true family
  6. 2176282Protein automated matches [191122] (9 species)
    not a true protein
  7. 2176308Species Helicobacter pylori [TaxId:85962] [257621] (1 PDB entry)
  8. 2176315Domain d4zglg_: 4zgl G: [273332]
    automated match to d4q61b_
    complexed with amp

Details for d4zglg_

PDB Entry: 4zgl (more details), 2.95 Å

PDB Description: hit like protein
PDB Compounds: (G:) Uncharacterized HIT-like protein HP_0404

SCOPe Domain Sequences for d4zglg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zglg_ d.13.1.0 (G:) automated matches {Helicobacter pylori [TaxId: 85962]}
mnvfekiiqgeipcskilenerflsfydinpkakvhalvipkqsiqdfngitpelmaqmt
sfifevveklgikekgyklltnvgknagqevmhlhfhilsg

SCOPe Domain Coordinates for d4zglg_:

Click to download the PDB-style file with coordinates for d4zglg_.
(The format of our PDB-style files is described here.)

Timeline for d4zglg_: