Lineage for d4zeja_ (4zej A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603918Species Pseudomonas stutzeri [TaxId:316] [259737] (2 PDB entries)
  8. 2603919Domain d4zeja_: 4zej A: [273320]
    automated match to d1jjeb_
    complexed with cl, zn

Details for d4zeja_

PDB Entry: 4zej (more details), 1.79 Å

PDB Description: crystal structure of dim-1 metallo-beta-lactamase exposed to ceftazidime
PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d4zeja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zeja_ d.157.1.0 (A:) automated matches {Pseudomonas stutzeri [TaxId: 316]}
devpelriekvkeniflhtsysrvngfglvssnglvvidkgnafivdtpwsdrdtetlvh
wirkngyellgsvsthwhedrtagikwlndqsistyattstnhllkenkkepakytlkgn
estlvdglievfypggghtidnvvvwlpkskilfggcfvrsldseglgytgeahidqwsr
saqnalsryseaqivipghgkigdiallkhtkslaetas

SCOPe Domain Coordinates for d4zeja_:

Click to download the PDB-style file with coordinates for d4zeja_.
(The format of our PDB-style files is described here.)

Timeline for d4zeja_: