SCOPe 2.06: Domain d4zeja_: 4zej A:

Lineage for d4zeja_ (4zej A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (18 species)
   not a true protein

7. Species Pseudomonas stutzeri [TaxId:316] [259737] (2 PDB entries)

8. Domain d4zeja_: 4zej A: [273320]
   automated match to d1jjeb_
   complexed with cl, zn

Details for d4zeja_

PDB Entry: 4zej, 1.79 Å

PDB Description: crystal structure of dim-1 metallo-beta-lactamase exposed to ceftazidime

PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d4zeja_:

Sequence; same for both SEQRES and ATOM records:

>d4zeja_ d.157.1.0 (A:) automated matches {Pseudomonas stutzeri [TaxId: 316]}
devpelriekvkeniflhtsysrvngfglvssnglvvidkgnafivdtpwsdrdtetlvh
wirkngyellgsvsthwhedrtagikwlndqsistyattstnhllkenkkepakytlkgn
estlvdglievfypggghtidnvvvwlpkskilfggcfvrsldseglgytgeahidqwsr
saqnalsryseaqivipghgkigdiallkhtkslaetas

Timeline for d4zeja_:

• d4zeja_ first appeared in SCOPe 2.05
  
• d4zeja_ appears in SCOPe 2.07
  
• d4zeja_ appears in the current release, SCOPe 2.08