Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (18 species) not a true protein |
Species Pseudomonas stutzeri [TaxId:316] [259737] (2 PDB entries) |
Domain d4zeja_: 4zej A: [273320] automated match to d1jjeb_ complexed with cl, zn |
PDB Entry: 4zej (more details), 1.79 Å
SCOPe Domain Sequences for d4zeja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zeja_ d.157.1.0 (A:) automated matches {Pseudomonas stutzeri [TaxId: 316]} devpelriekvkeniflhtsysrvngfglvssnglvvidkgnafivdtpwsdrdtetlvh wirkngyellgsvsthwhedrtagikwlndqsistyattstnhllkenkkepakytlkgn estlvdglievfypggghtidnvvvwlpkskilfggcfvrsldseglgytgeahidqwsr saqnalsryseaqivipghgkigdiallkhtkslaetas
Timeline for d4zeja_: