Lineage for d4yxra_ (4yxr A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1929523Protein cAMP-dependent PK, catalytic subunit [56116] (5 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 1929526Species Cow (Bos taurus) [TaxId:9913] [56118] (40 PDB entries)
    Uniprot P00517
  8. 1929556Domain d4yxra_: 4yxr A: [273317]
    Other proteins in same PDB: d4yxri_
    automated match to d1smha_
    complexed with 0rw

Details for d4yxra_

PDB Entry: 4yxr (more details), 2 Å

PDB Description: crystal structure of pka in complex with inhibitor.
PDB Compounds: (A:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d4yxra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yxra_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]}
vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
vrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyqrkveapf
ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOPe Domain Coordinates for d4yxra_:

Click to download the PDB-style file with coordinates for d4yxra_.
(The format of our PDB-style files is described here.)

Timeline for d4yxra_: