Lineage for d4z1lz_ (4z1l Z:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1934686Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
    contains an extension to the common fold at the N-terminus
  7. 1934702Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (76 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1935261Domain d4z1lz_: 4z1l Z: [273315]
    Other proteins in same PDB: d4z1lb_, d4z1lc_, d4z1ld_, d4z1lf_, d4z1lg_, d4z1lh_, d4z1lm_, d4z1lp_, d4z1lq_, d4z1lr_, d4z1lt_, d4z1lu_, d4z1lv_
    automated match to d4j70l_
    complexed with 4kf, cl, mg

Details for d4z1lz_

PDB Entry: 4z1l (more details), 3 Å

PDB Description: yeast 20s proteasome in complex with belactosin c derivative 3
PDB Compounds: (Z:) Proteasome subunit beta type-6

SCOPe Domain Sequences for d4z1lz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z1lz_ d.153.1.4 (Z:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOPe Domain Coordinates for d4z1lz_:

Click to download the PDB-style file with coordinates for d4z1lz_.
(The format of our PDB-style files is described here.)

Timeline for d4z1lz_: