Lineage for d1swbc_ (1swb C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2805820Protein Streptavidin [50878] (1 species)
  7. 2805821Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)
  8. 2805971Domain d1swbc_: 1swb C: [27331]

Details for d1swbc_

PDB Entry: 1swb (more details), 1.85 Å

PDB Description: apo-core-streptavidin at ph 7.5
PDB Compounds: (C:) streptavidin

SCOPe Domain Sequences for d1swbc_:

Sequence, based on SEQRES records: (download)

>d1swbc_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records): (download)

>d1swbc_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesnaesryvltgrydsapatdgsgtalgwtva
wknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

SCOPe Domain Coordinates for d1swbc_:

Click to download the PDB-style file with coordinates for d1swbc_.
(The format of our PDB-style files is described here.)

Timeline for d1swbc_: