Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries) |
Domain d4z1lp_: 4z1l P: [273306] Other proteins in same PDB: d4z1la_, d4z1le_, d4z1li_, d4z1lj_, d4z1lk_, d4z1ll_, d4z1ln_, d4z1lo_, d4z1ls_, d4z1lw_, d4z1lx_, d4z1ly_, d4z1lz_ automated match to d1rypc_ complexed with 4kf, cl, mg |
PDB Entry: 4z1l (more details), 3 Å
SCOPe Domain Sequences for d4z1lp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z1lp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4z1lp_: