Lineage for d4z1lg_ (4z1l G:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries)
  8. 1936949Domain d4z1lg_: 4z1l G: [273294]
    Other proteins in same PDB: d4z1la_, d4z1le_, d4z1li_, d4z1lj_, d4z1lk_, d4z1ll_, d4z1ln_, d4z1lo_, d4z1ls_, d4z1lw_, d4z1lx_, d4z1ly_, d4z1lz_
    automated match to d1rypa_
    complexed with 4kf, cl, mg

Details for d4z1lg_

PDB Entry: 4z1l (more details), 3 Å

PDB Description: yeast 20s proteasome in complex with belactosin c derivative 3
PDB Compounds: (G:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4z1lg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z1lg_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d4z1lg_:

Click to download the PDB-style file with coordinates for d4z1lg_.
(The format of our PDB-style files is described here.)

Timeline for d4z1lg_: