SCOPe 2.08: Domain d4yk4b2: 4yk4 B:107-211

Lineage for d4yk4b2 (4yk4 B:107-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4yk4b2: 4yk4 B:107-211 [273287]
   Other proteins in same PDB: d4yk4b1, d4yk4c1, d4yk4c2, d4yk4y1, d4yk4z1, d4yk4z2
   automated match to d1dn0a2
   complexed with nag

Details for d4yk4b2

PDB Entry: 4yk4, 2.8 Å

PDB Description: human antibody 641 i-9 in complex with influenza hemagglutinin h1 solomon islands/03/2006

PDB Compounds: (B:) 641 I-9 VLCL antibody

SCOPe Domain Sequences for d4yk4b2:

Sequence; same for both SEQRES and ATOM records:

>d4yk4b2 b.1.1.2 (B:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d4yk4b2:

• d4yk4b2 first appeared in SCOPe 2.05
  
• d4yk4b2 appears in SCOPe 2.07