SCOPe 2.05: Domain d4ymga_: 4ymg A:

Lineage for d4ymga_ (4ymg A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (49 species)
   not a true protein

7. Species Podospora anserina [TaxId:5145] [273138] (3 PDB entries)

8. Domain d4ymga_: 4ymg A: [273283]
   automated match to d2hnkc_
   complexed with mg, pg4, po4, sam

Details for d4ymga_

PDB Entry: 4ymg, 1.9 Å

PDB Description: crystal structure of sam-bound podospora anserina methyltransferase pamth1

PDB Compounds: (A:) Putative SAM-dependent O-methyltranferase

SCOPe Domain Sequences for d4ymga_:

Sequence; same for both SEQRES and ATOM records:

>d4ymga_ c.66.1.0 (A:) automated matches {Podospora anserina [TaxId: 5145]}
lgsilpfneetadrvsayceknshgipdalvehwewtrtrfpdadkmssrlqgswmifta
rdrkpkrileigcysgysalawyegtrdtkaeivtleyspkmiaasreafkkygvgdrvk
liegpaentlktlegefdlifvdankdgyagyvktildqgllsangiilcdnvfarglti
gpdcapwlndhvrpywngcgqaldkfsaglmedpridvlllpvfdgvtqirwkd

Timeline for d4ymga_:

• d4ymga_ is new in SCOPe 2.05-stable
  
• d4ymga_ appears in SCOPe 2.06
  
• d4ymga_ appears in the current release, SCOPe 2.08