Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (49 species) not a true protein |
Species Podospora anserina [TaxId:5145] [273138] (3 PDB entries) |
Domain d4ymga_: 4ymg A: [273283] automated match to d2hnkc_ complexed with mg, pg4, po4, sam |
PDB Entry: 4ymg (more details), 1.9 Å
SCOPe Domain Sequences for d4ymga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ymga_ c.66.1.0 (A:) automated matches {Podospora anserina [TaxId: 5145]} lgsilpfneetadrvsayceknshgipdalvehwewtrtrfpdadkmssrlqgswmifta rdrkpkrileigcysgysalawyegtrdtkaeivtleyspkmiaasreafkkygvgdrvk liegpaentlktlegefdlifvdankdgyagyvktildqgllsangiilcdnvfarglti gpdcapwlndhvrpywngcgqaldkfsaglmedpridvlllpvfdgvtqirwkd
Timeline for d4ymga_: