Lineage for d4ymhc_ (4ymh C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894984Species Podospora anserina [TaxId:5145] [273138] (3 PDB entries)
  8. 2894987Domain d4ymhc_: 4ymh C: [273281]
    automated match to d2hnkc_
    complexed with peg, sah

Details for d4ymhc_

PDB Entry: 4ymh (more details), 1.88 Å

PDB Description: crystal structure of sah-bound podospora anserina methyltransferase pamth1
PDB Compounds: (C:) Putative SAM-dependent O-methyltranferase

SCOPe Domain Sequences for d4ymhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ymhc_ c.66.1.0 (C:) automated matches {Podospora anserina [TaxId: 5145]}
lgsilpfneetadrvsayceknshgipdalvehwewtrtrfpdadkmssrlqgswmifta
rdrkpkrileigcysgysalawyegtrdtkaeivtleyspkmiaasreafkkygvgdrvk
liegpaentlktlegefdlifvdankdgyagyvktildqgllsangiilcdnvfarglti
gpdcapwlndhvrpywngcgqaldkfsaglmedpridvlllpvfdgvtqirwkdg

SCOPe Domain Coordinates for d4ymhc_:

Click to download the PDB-style file with coordinates for d4ymhc_.
(The format of our PDB-style files is described here.)

Timeline for d4ymhc_: