Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (6 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226564] (16 PDB entries) |
Domain d4yj2d1: 4yj2 D:1-245 [273277] Other proteins in same PDB: d4yj2a2, d4yj2b2, d4yj2c2, d4yj2d2, d4yj2e_ automated match to d4drxb1 complexed with 4ed, ca, gdp, gol, gtp, imd, mes, mg |
PDB Entry: 4yj2 (more details), 2.6 Å
SCOPe Domain Sequences for d4yj2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yj2d1 c.32.1.1 (D:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d4yj2d1: