Lineage for d4yj2d1 (4yj2 D:1-245)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843633Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1843634Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1843635Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1843745Protein automated matches [226837] (6 species)
    not a true protein
  7. 1843746Species Cow (Bos taurus) [TaxId:9913] [226564] (16 PDB entries)
  8. 1843810Domain d4yj2d1: 4yj2 D:1-245 [273277]
    Other proteins in same PDB: d4yj2a2, d4yj2b2, d4yj2c2, d4yj2d2, d4yj2e_
    automated match to d4drxb1
    complexed with 4ed, ca, gdp, gol, gtp, imd, mes, mg

Details for d4yj2d1

PDB Entry: 4yj2 (more details), 2.6 Å

PDB Description: crystal structure of tubulin bound to mi-181
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4yj2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yj2d1 c.32.1.1 (D:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d4yj2d1:

Click to download the PDB-style file with coordinates for d4yj2d1.
(The format of our PDB-style files is described here.)

Timeline for d4yj2d1: