SCOPe 2.08: Domain d4yj2d1: 4yj2 D:1-245

Lineage for d4yj2d1 (4yj2 D:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)

8. Domain d4yj2d1: 4yj2 D:1-245 [273277]
   Other proteins in same PDB: d4yj2a2, d4yj2b2, d4yj2c2, d4yj2d2, d4yj2e_, d4yj2f1, d4yj2f2
   automated match to d4drxb1
   complexed with 4ed, ca, gdp, gol, gtp, imd, mes, mg

Details for d4yj2d1

PDB Entry: 4yj2, 2.6 Å

PDB Description: crystal structure of tubulin bound to mi-181

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4yj2d1:

Sequence; same for both SEQRES and ATOM records:

>d4yj2d1 c.32.1.1 (D:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d4yj2d1:

• d4yj2d1 first appeared in SCOPe 2.05
  
• d4yj2d1 appears in SCOPe 2.07