| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
| Family a.137.10.1: Stathmin [101495] (2 proteins) |
| Protein Stathmin 4 [101496] (3 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
| Domain d4yj2e_: 4yj2 E: [273276] Other proteins in same PDB: d4yj2a1, d4yj2a2, d4yj2b1, d4yj2b2, d4yj2c1, d4yj2c2, d4yj2d1, d4yj2d2, d4yj2f1, d4yj2f2 automated match to d3ryce_ complexed with 4ed, ca, gdp, gol, gtp, imd, mes, mg |
PDB Entry: 4yj2 (more details), 2.6 Å
SCOPe Domain Sequences for d4yj2e_:
Sequence, based on SEQRES records: (download)
>d4yj2e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke
>d4yj2e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqswevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e
Timeline for d4yj2e_: