Lineage for d4y4kd2 (4y4k D:113-240)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2371216Domain d4y4kd2: 4y4k D:113-240 [273266]
    Other proteins in same PDB: d4y4ka1, d4y4kb_, d4y4kc2
    automated match to d3q5ya2
    complexed with 49y, fuc, nag

Details for d4y4kd2

PDB Entry: 4y4k (more details), 2.9 Å

PDB Description: crystal structure of the mcd1d/ef77/inktcr ternary complex
PDB Compounds: (D:) chimeric TCR Vbeta8.2 chain (mouse variable, human constant domain)

SCOPe Domain Sequences for d4y4kd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y4kd2 b.1.1.0 (D:113-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d4y4kd2:

Click to download the PDB-style file with coordinates for d4y4kd2.
(The format of our PDB-style files is described here.)

Timeline for d4y4kd2: