Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) |
Domain d4y4kc1: 4y4k C:1-114 [273258] Other proteins in same PDB: d4y4ka1, d4y4kb_, d4y4kc2 automated match to d2pyfa1 complexed with 49y, fuc, nag |
PDB Entry: 4y4k (more details), 2.9 Å
SCOPe Domain Sequences for d4y4kc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y4kc1 b.1.1.0 (C:1-114) automated matches {Human (Homo sapiens) [TaxId: 9606]} tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd
Timeline for d4y4kc1: