SCOPe 2.05: Domain d4y4kc1: 4y4k C:1-114

Lineage for d4y4kc1 (4y4k C:1-114)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4y4kc1: 4y4k C:1-114 [273258]
   Other proteins in same PDB: d4y4ka1, d4y4kb_, d4y4kc2
   automated match to d2pyfa1
   complexed with 49y, fuc, nag

Details for d4y4kc1

PDB Entry: 4y4k, 2.9 Å

PDB Description: crystal structure of the mcd1d/ef77/inktcr ternary complex

PDB Compounds: (C:) chimeric TCR Valpha14Jalpha18 chain (mouse variable, human constant domain)

SCOPe Domain Sequences for d4y4kc1:

Sequence; same for both SEQRES and ATOM records:

>d4y4kc1 b.1.1.0 (C:1-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d4y4kc1:

• d4y4kc1 is new in SCOPe 2.05-stable
  
• d4y4kc1 appears in SCOPe 2.06
  
• d4y4kc1 appears in the current release, SCOPe 2.08