| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d4y4fh2: 4y4f H:113-240 [273256] Other proteins in same PDB: d4y4fa1, d4y4fb_, d4y4fc2, d4y4fe1, d4y4ff_, d4y4fg2 automated match to d3q5ya2 complexed with 49m, nag |
PDB Entry: 4y4f (more details), 3.19 Å
SCOPe Domain Sequences for d4y4fh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y4fh2 b.1.1.0 (H:113-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra
Timeline for d4y4fh2: