SCOPe 2.07: Domain d4y4fd1: 4y4f D:2-112

Lineage for d4y4fd1 (4y4f D:2-112)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d4y4fd1: 4y4f D:2-112 [273251]
   Other proteins in same PDB: d4y4fa1, d4y4fb_, d4y4fc2, d4y4fe1, d4y4ff_, d4y4fg2
   automated match to d3q5ya1
   complexed with 49m, nag

Details for d4y4fd1

PDB Entry: 4y4f, 3.19 Å

PDB Description: crystal structure of the mcd1d/gck127/inktcr ternary complex

PDB Compounds: (D:) Chimeric TCR Vbeta8.2 chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4y4fd1:

Sequence; same for both SEQRES and ATOM records:

>d4y4fd1 b.1.1.0 (D:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

Timeline for d4y4fd1:

• d4y4fd1 first appeared in SCOPe 2.05
  
• d4y4fd1 appears in SCOPe 2.06
  
• d4y4fd1 appears in the current release, SCOPe 2.08