Lineage for d1swgd_ (1swg D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2415301Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2415302Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2415334Protein Streptavidin [50878] (1 species)
  7. 2415335Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)
  8. 2415635Domain d1swgd_: 1swg D: [27325]
    circular permuted streptavidin e51/a46
    complexed with btn

Details for d1swgd_

PDB Entry: 1swg (more details), 1.8 Å

PDB Description: circular permuted streptavidin e51/a46 in complex with biotin
PDB Compounds: (D:) circularly permuted core-streptavidin e51/a46

SCOPe Domain Sequences for d1swgd_:

Sequence, based on SEQRES records: (download)

>d1swgd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
esryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwll
tsgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagadgal
tgtyes

Sequence, based on observed residues (ATOM records): (download)

>d1swgd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
esryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwll
tsgtteanawkstlvghdtftkvgitgtwynqlgstfivtagadgaltgtyes

SCOPe Domain Coordinates for d1swgd_:

Click to download the PDB-style file with coordinates for d1swgd_.
(The format of our PDB-style files is described here.)

Timeline for d1swgd_: