Lineage for d4y4ka1 (4y4k A:6-185)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimericSuperfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) 
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
Class I MHC-relatedSpecies Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries) 
Domain d4y4ka1: 4y4k A:6-185 [273249]
Other proteins in same PDB: d4y4ka2, d4y4kb_, d4y4kc1, d4y4kc2, d4y4kd1, d4y4kd2
automated match to d3hujc1
complexed with 49y, fuc, nag
Details for d4y4ka1
PDB Entry: 4y4k (more details), 2.9 Å
PDB Description: crystal structure of the mcd1d/ef77/inktcr ternary complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1SCOPe Domain Sequences for d4y4ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y4ka1 d.19.1.1 (A:6-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
SCOPe Domain Coordinates for d4y4ka1:
Click to download the PDB-style file with coordinates for d4y4ka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4y4ka1:
View in 3D
