Lineage for d4y4hc2 (4y4h C:116-204)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (683 PDB entries)
  8. 2025357Domain d4y4hc2: 4y4h C:116-204 [273248]
    Other proteins in same PDB: d4y4ha1, d4y4ha2, d4y4hb_, d4y4hc1, d4y4hd1, d4y4hd2, d4y4he1, d4y4he2, d4y4hf_, d4y4hg1, d4y4hh1, d4y4hh2
    automated match to d2pyfa2
    complexed with 49x, nag

Details for d4y4hc2

PDB Entry: 4y4h (more details), 3.1 Å

PDB Description: crystal structure of the mcd1d/gck152/inktcr ternary complex
PDB Compounds: (C:) Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain/ human constant domain)

SCOPe Domain Sequences for d4y4hc2:

Sequence, based on SEQRES records: (download)

>d4y4hc2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d4y4hc2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d4y4hc2:

Click to download the PDB-style file with coordinates for d4y4hc2.
(The format of our PDB-style files is described here.)

Timeline for d4y4hc2: