![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d4y4hc2: 4y4h C:116-204 [273248] Other proteins in same PDB: d4y4ha1, d4y4ha2, d4y4hb_, d4y4hc1, d4y4hd1, d4y4hd2, d4y4he1, d4y4he2, d4y4hf_, d4y4hg1, d4y4hh1, d4y4hh2 automated match to d2pyfa2 complexed with 49x, nag |
PDB Entry: 4y4h (more details), 3.1 Å
SCOPe Domain Sequences for d4y4hc2:
Sequence, based on SEQRES records: (download)
>d4y4hc2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
>d4y4hc2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnkdfacanafnnsiipedtffps
Timeline for d4y4hc2: