Lineage for d4y4ha2 (4y4h A:186-279)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760965Domain d4y4ha2: 4y4h A:186-279 [273238]
    Other proteins in same PDB: d4y4ha1, d4y4hb_, d4y4hc2, d4y4he1, d4y4hf_, d4y4hg2
    automated match to d3hujc2
    complexed with 49x, nag

Details for d4y4ha2

PDB Entry: 4y4h (more details), 3.1 Å

PDB Description: crystal structure of the mcd1d/gck152/inktcr ternary complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d4y4ha2:

Sequence, based on SEQRES records: (download)

>d4y4ha2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d4y4ha2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvprqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatl
dveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d4y4ha2:

Click to download the PDB-style file with coordinates for d4y4ha2.
(The format of our PDB-style files is described here.)

Timeline for d4y4ha2: