![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (26 species) not a true protein |
![]() | Species Mus musculus, [TaxId:10090] [272265] (6 PDB entries) |
![]() | Domain d4y2dd2: 4y2d D:113-240 [273236] Other proteins in same PDB: d4y2da1, d4y2db_, d4y2dc2, d4y2de1, d4y2df_, d4y2dg2 automated match to d3q5ya2 complexed with 7dw, fu4, nag |
PDB Entry: 4y2d (more details), 3.05 Å
SCOPe Domain Sequences for d4y2dd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y2dd2 b.1.1.0 (D:113-240) automated matches {Mus musculus, [TaxId: 10090]} dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
Timeline for d4y2dd2: