Lineage for d4y2dd1 (4y2d D:2-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760749Domain d4y2dd1: 4y2d D:2-112 [273235]
    Other proteins in same PDB: d4y2da1, d4y2db_, d4y2dc2, d4y2de1, d4y2df_, d4y2dg2
    automated match to d3q5ya1
    complexed with 7dw, fuc, nag

Details for d4y2dd1

PDB Entry: 4y2d (more details), 3.05 Å

PDB Description: crystal structure of the mcd1d/7dw8-5/inktcr ternary complex
PDB Compounds: (D:) Chimeric TCR Vbeta8.2 chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4y2dd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y2dd1 b.1.1.0 (D:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d4y2dd1:

Click to download the PDB-style file with coordinates for d4y2dd1.
(The format of our PDB-style files is described here.)

Timeline for d4y2dd1: