| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d4y4fc2: 4y4f C:116-204 [273231] Other proteins in same PDB: d4y4fa1, d4y4fa2, d4y4fb_, d4y4fc1, d4y4fd1, d4y4fd2, d4y4fe1, d4y4fe2, d4y4ff_, d4y4fg1, d4y4fh1, d4y4fh2 automated match to d2pyfa2 complexed with 49m, nag |
PDB Entry: 4y4f (more details), 3.19 Å
SCOPe Domain Sequences for d4y4fc2:
Sequence, based on SEQRES records: (download)
>d4y4fc2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps
>d4y4fc2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps
Timeline for d4y4fc2: