Lineage for d4y4fc2 (4y4f C:116-204)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751731Domain d4y4fc2: 4y4f C:116-204 [273231]
    Other proteins in same PDB: d4y4fa1, d4y4fa2, d4y4fb_, d4y4fc1, d4y4fd1, d4y4fd2, d4y4fe1, d4y4fe2, d4y4ff_, d4y4fg1, d4y4fh1, d4y4fh2
    automated match to d2pyfa2
    complexed with 49m, nag

Details for d4y4fc2

PDB Entry: 4y4f (more details), 3.19 Å

PDB Description: crystal structure of the mcd1d/gck127/inktcr ternary complex
PDB Compounds: (C:) Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain/ human constant domain)

SCOPe Domain Sequences for d4y4fc2:

Sequence, based on SEQRES records: (download)

>d4y4fc2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d4y4fc2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d4y4fc2:

Click to download the PDB-style file with coordinates for d4y4fc2.
(The format of our PDB-style files is described here.)

Timeline for d4y4fc2: