Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Mus musculus, [TaxId:10090] [272265] (6 PDB entries) |
Domain d4y2dg1: 4y2d G:2-115 [273228] Other proteins in same PDB: d4y2da1, d4y2db_, d4y2dc2, d4y2de1, d4y2df_, d4y2dg2 automated match to d2pyfa1 complexed with 7dw, fu4, nag |
PDB Entry: 4y2d (more details), 3.05 Å
SCOPe Domain Sequences for d4y2dg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y2dg1 b.1.1.0 (G:2-115) automated matches {Mus musculus, [TaxId: 10090]} tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd
Timeline for d4y2dg1: