SCOPe 2.08: Domain d4y2dc2: 4y2d C:116-204

Lineage for d4y2dc2 (4y2d C:116-204)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4y2dc2: 4y2d C:116-204 [273224]
   Other proteins in same PDB: d4y2da1, d4y2db_, d4y2dc1, d4y2dd1, d4y2dd2, d4y2de1, d4y2df_, d4y2dg1, d4y2dh1, d4y2dh2
   automated match to d2pyfa2
   complexed with 7dw, fuc, nag

Details for d4y2dc2

PDB Entry: 4y2d, 3.05 Å

PDB Description: crystal structure of the mcd1d/7dw8-5/inktcr ternary complex

PDB Compounds: (C:) Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4y2dc2:

Sequence, based on SEQRES records:

>d4y2dc2 b.1.1.2 (C:116-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d4y2dc2 b.1.1.2 (C:116-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps

Timeline for d4y2dc2:

• d4y2dc2 first appeared in SCOPe 2.05
  
• d4y2dc2 appears in SCOPe 2.07