SCOPe 2.05: Domain d4y2dc1: 4y2d C:2-115

Lineage for d4y2dc1 (4y2d C:2-115)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mus musculus, [TaxId:10090] [272265] (6 PDB entries)

8. Domain d4y2dc1: 4y2d C:2-115 [273223]
   Other proteins in same PDB: d4y2da1, d4y2db_, d4y2dc2, d4y2de1, d4y2df_, d4y2dg2
   automated match to d2pyfa1
   complexed with 7dw, fu4, nag

Details for d4y2dc1

PDB Entry: 4y2d, 3.05 Å

PDB Description: crystal structure of the mcd1d/7dw8-5/inktcr ternary complex

PDB Compounds: (C:) Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4y2dc1:

Sequence; same for both SEQRES and ATOM records:

>d4y2dc1 b.1.1.0 (C:2-115) automated matches {Mus musculus, [TaxId: 10090]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d4y2dc1:

• d4y2dc1 is new in SCOPe 2.05-stable
  
• d4y2dc1 appears in SCOPe 2.06
  
• d4y2dc1 appears in the current release, SCOPe 2.08