![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d4y2dc1: 4y2d C:2-115 [273223] Other proteins in same PDB: d4y2da1, d4y2db_, d4y2dc2, d4y2de1, d4y2df_, d4y2dg2 automated match to d2pyfa1 complexed with 7dw, fuc, nag |
PDB Entry: 4y2d (more details), 3.05 Å
SCOPe Domain Sequences for d4y2dc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y2dc1 b.1.1.0 (C:2-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd
Timeline for d4y2dc1: