Lineage for d1swga_ (1swg A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1800830Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1800831Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1800832Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1800855Protein Streptavidin [50878] (1 species)
  7. 1800856Species Streptomyces avidinii [TaxId:1895] [50879] (124 PDB entries)
  8. 1801140Domain d1swga_: 1swg A: [27322]
    circular permuted streptavidin e51/a46
    complexed with btn

Details for d1swga_

PDB Entry: 1swg (more details), 1.8 Å

PDB Description: circular permuted streptavidin e51/a46 in complex with biotin
PDB Compounds: (A:) circularly permuted core-streptavidin e51/a46

SCOPe Domain Sequences for d1swga_:

Sequence, based on SEQRES records: (download)

>d1swga_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
sryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwllt
sgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagadgalt
gtyesa

Sequence, based on observed residues (ATOM records): (download)

>d1swga_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
sryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwllt
sgtteanawkstlvghdtftkgitgtwynqlgstfivtagadgaltgtyesa

SCOPe Domain Coordinates for d1swga_:

Click to download the PDB-style file with coordinates for d1swga_.
(The format of our PDB-style files is described here.)

Timeline for d1swga_: