Lineage for d4uscb_ (4usc B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328973Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2328974Protein automated matches [191104] (13 species)
    not a true protein
  7. 2329088Species Trachycarpus fortunei [TaxId:14027] [273214] (1 PDB entry)
  8. 2329090Domain d4uscb_: 4usc B: [273216]
    automated match to d3hdla_
    complexed with ca, edo, hem, man, nag, peg, peo, so4

Details for d4uscb_

PDB Entry: 4usc (more details), 2.6 Å

PDB Description: crystal structure of peroxidase from palm tree chamaerops excelsa
PDB Compounds: (B:) Peroxidase

SCOPe Domain Sequences for d4uscb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uscb_ a.93.1.0 (B:) automated matches {Trachycarpus fortunei [TaxId: 14027]}
dlqigfynqscpsaeslvqqgvaaafannsgiapglirmhfhdcfvrgcdgsvlldstdt
ntaekdaapnnpslrgfeviaaaksaveaacpktvscadilafaardsaalagnityqvp
sgrrdgnvslasealtnipaptfnatqlinsfagknltademvtlsgahsigvshcfsfl
nriynfsntsqvdptlsssyadllrtkcpsnstrftpitvsldiitptvldnryytgvql
tlglltsdqalvteanlsaavknnadnltawvaefaqaivkmgqievltgtqgeirtncs
vvn

SCOPe Domain Coordinates for d4uscb_:

Click to download the PDB-style file with coordinates for d4uscb_.
(The format of our PDB-style files is described here.)

Timeline for d4uscb_: