Lineage for d4usca_ (4usc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333804Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2333805Protein automated matches [191104] (14 species)
    not a true protein
  7. 2333973Species Trachycarpus fortunei [TaxId:14027] [273214] (1 PDB entry)
  8. 2333974Domain d4usca_: 4usc A: [273215]
    automated match to d3hdla_
    complexed with ca, edo, hem, man, nag, peg, peo, so4

Details for d4usca_

PDB Entry: 4usc (more details), 2.6 Å

PDB Description: crystal structure of peroxidase from palm tree chamaerops excelsa
PDB Compounds: (A:) Peroxidase

SCOPe Domain Sequences for d4usca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4usca_ a.93.1.0 (A:) automated matches {Trachycarpus fortunei [TaxId: 14027]}
dlqigfynqscpsaeslvqqgvaaafannsgiapglirmhfhdcfvrgcdgsvlldstdt
ntaekdaapnnpslrgfeviaaaksaveaacpktvscadilafaardsaalagnityqvp
sgrrdgnvslasealtnipaptfnatqlinsfagknltademvtlsgahsigvshcfsfl
nriynfsntsqvdptlsssyadllrtkcpsnstrftpitvsldiitptvldnryytgvql
tlglltsdqalvteanlsaavknnadnltawvaefaqaivkmgqievltgtqgeirtncs
vvn

SCOPe Domain Coordinates for d4usca_:

Click to download the PDB-style file with coordinates for d4usca_.
(The format of our PDB-style files is described here.)

Timeline for d4usca_: