SCOPe 2.06: Domain d4udjc_: 4udj C:

Lineage for d4udjc_ (4udj C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.4: TM1225-like predicted glycosylases [110284] (2 proteins)
   Pfam PF04041 DUF377

6. Protein automated matches [273186] (2 species)
   not a true protein

7. Species uncultured organism [TaxId:155900] [273187] (4 PDB entries)

8. Domain d4udjc_: 4udj C: [273211]
   automated match to d1vkda_
   complexed with bma, edo, k, pge, po4

Details for d4udjc_

PDB Entry: 4udj, 1.94 Å

PDB Description: crystal structure of b-1,4-mannopyranosyl-chitobiose phosphorylase at 1.60 angstrom in complex with beta-d-mannopyranose and inorganic phosphate

PDB Compounds: (C:) uhgb_mp

SCOPe Domain Sequences for d4udjc_:

Sequence; same for both SEQRES and ATOM records:

>d4udjc_ b.67.2.4 (C:) automated matches {uncultured organism [TaxId: 155900]}
iipweerpagckdvlwrsvanpiiprdllptsnsifnsavvpfgdgfagvfrcddtsrrm
rlhvgfskdainwnikeeplkfqcddeeigtwvygydprvcfiedryyvtwcngyhgpti
gvaytfdfetfhqlenafipfnrngvlfprkingrfamlsrpsdnghtpfgdifysespd
mefwgrhrhvmspaafevsawqctkigagpipvetpegwlliyhgvlhscngyvysfgsa
lldldepwkvkfrsgpyllaprepyecmgdvpnvcfpcaalhdnetgriaiyygcadtvt
glafgyipeiieftkrtsii

Timeline for d4udjc_:

• d4udjc_ first appeared in SCOPe 2.05
  
• d4udjc_ appears in SCOPe 2.07
  
• d4udjc_ appears in the current release, SCOPe 2.08