SCOPe 2.08: Domain d4udia_: 4udi A:

Lineage for d4udia_ (4udi A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.4: TM1225-like predicted glycosylases [110284] (2 proteins)
   Pfam PF04041 DUF377

6. Protein automated matches [273186] (2 species)
   not a true protein

7. Species uncultured organism [TaxId:155900] [273187] (4 PDB entries)

8. Domain d4udia_: 4udi A: [273195]
   automated match to d1vkda_
   complexed with edo, gol, k, pge, po4

Details for d4udia_

PDB Entry: 4udi, 1.8 Å

PDB Description: crystal structure of b-1,4-mannopyranosyl-chitobiose phosphorylase at 1.85 angstrom from unknown human gut bacteria (uhgb_mp)

PDB Compounds: (A:) uhgb_mp

SCOPe Domain Sequences for d4udia_:

Sequence; same for both SEQRES and ATOM records:

>d4udia_ b.67.2.4 (A:) automated matches {uncultured organism [TaxId: 155900]}
viipweerpagckdvlwrsvanpiiprdllptsnsifnsavvpfgdgfagvfrcddtsrr
mrlhvgfskdainwnikeeplkfqcddeeigtwvygydprvcfiedryyvtwcngyhgpt
igvaytfdfetfhqlenafipfnrngvlfprkingrfamlsrpsdnghtpfgdifysesp
dmefwgrhrhvmspaafevsawqctkigagpipvetpegwlliyhgvlhscngyvysfgs
alldldepwkvkfrsgpyllaprepyecmgdvpnvcfpcaalhdnetgriaiyygcadtv
tglafgyipeiieftkrtsii

Timeline for d4udia_:

• d4udia_ first appeared in SCOPe 2.05
  
• d4udia_ appears in SCOPe 2.07