Class b: All beta proteins [48724] (177 folds) |
Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) |
Family b.67.2.4: TM1225-like predicted glycosylases [110284] (2 proteins) Pfam PF04041 DUF377 |
Protein automated matches [273186] (2 species) not a true protein |
Species uncultured organism [TaxId:155900] [273187] (4 PDB entries) |
Domain d4udgf_: 4udg F: [273193] automated match to d1vkda_ complexed with edo, gol, k, ndg, po4 |
PDB Entry: 4udg (more details), 1.6 Å
SCOPe Domain Sequences for d4udgf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4udgf_ b.67.2.4 (F:) automated matches {uncultured organism [TaxId: 155900]} iipweerpagckdvlwrsvanpiiprdllptsnsifnsavvpfgdgfagvfrcddtsrrm rlhvgfskdainwnikeeplkfqcddeeigtwvygydprvcfiedryyvtwcngyhgpti gvaytfdfetfhqlenafipfnrngvlfprkingrfamlsrpsdnghtpfgdifysespd mefwgrhrhvmspaafevsawqctkigagpipvetpegwlliyhgvlhscngyvysfgsa lldldepwkvkfrsgpyllaprepyecmgdvpnvcfpcaalhdnetgriaiyygcadtvt glafgyipeiieftkrtsii
Timeline for d4udgf_: