Lineage for d4udge_ (4udg E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807321Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2807331Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2807462Family b.67.2.4: TM1225-like predicted glycosylases [110284] (2 proteins)
    Pfam PF04041 DUF377
  6. 2807471Protein automated matches [273186] (2 species)
    not a true protein
  7. 2807485Species uncultured organism [TaxId:155900] [273187] (4 PDB entries)
  8. 2807490Domain d4udge_: 4udg E: [273192]
    automated match to d1vkda_
    complexed with edo, gol, k, ndg, po4

Details for d4udge_

PDB Entry: 4udg (more details), 1.6 Å

PDB Description: crystal structure of b-1,4-mannopyranosyl-chitobiose phosphorylase at 1.60 angstrom in complex with n-acetylglucosamine and inorganic phosphate
PDB Compounds: (E:) uhgb_mp

SCOPe Domain Sequences for d4udge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4udge_ b.67.2.4 (E:) automated matches {uncultured organism [TaxId: 155900]}
viipweerpagckdvlwrsvanpiiprdllptsnsifnsavvpfgdgfagvfrcddtsrr
mrlhvgfskdainwnikeeplkfqcddeeigtwvygydprvcfiedryyvtwcngyhgpt
igvaytfdfetfhqlenafipfnrngvlfprkingrfamlsrpsdnghtpfgdifysesp
dmefwgrhrhvmspaafevsawqctkigagpipvetpegwlliyhgvlhscngyvysfgs
alldldepwkvkfrsgpyllaprepyecmgdvpnvcfpcaalhdnetgriaiyygcadtv
tglafgyipeiieftkrtsii

SCOPe Domain Coordinates for d4udge_:

Click to download the PDB-style file with coordinates for d4udge_.
(The format of our PDB-style files is described here.)

Timeline for d4udge_: