Lineage for d4udga_ (4udg A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802003Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 1802009Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 1802118Family b.67.2.4: TM1225-like predicted glycosylases [110284] (2 proteins)
    Pfam PF04041 DUF377
  6. 1802127Protein automated matches [273186] (1 species)
    not a true protein
  7. 1802128Species Uncultured organism [TaxId:155900] [273187] (4 PDB entries)
  8. 1802129Domain d4udga_: 4udg A: [273189]
    automated match to d1vkda_
    complexed with edo, gol, k, ndg, po4

Details for d4udga_

PDB Entry: 4udg (more details), 1.6 Å

PDB Description: crystal structure of b-1,4-mannopyranosyl-chitobiose phosphorylase at 1.60 angstrom in complex with n-acetylglucosamine and inorganic phosphate
PDB Compounds: (A:) uhgb_mp

SCOPe Domain Sequences for d4udga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4udga_ b.67.2.4 (A:) automated matches {Uncultured organism [TaxId: 155900]}
iipweerpagckdvlwrsvanpiiprdllptsnsifnsavvpfgdgfagvfrcddtsrrm
rlhvgfskdainwnikeeplkfqcddeeigtwvygydprvcfiedryyvtwcngyhgpti
gvaytfdfetfhqlenafipfnrngvlfprkingrfamlsrpsdnghtpfgdifysespd
mefwgrhrhvmspaafevsawqctkigagpipvetpegwlliyhgvlhscngyvysfgsa
lldldepwkvkfrsgpyllaprepyecmgdvpnvcfpcaalhdnetgriaiyygcadtvt
glafgyipeiieftkrtsii

SCOPe Domain Coordinates for d4udga_:

Click to download the PDB-style file with coordinates for d4udga_.
(The format of our PDB-style files is described here.)

Timeline for d4udga_: