SCOP 1.75: Domain d1swcb_: 1swc B:

Lineage for d1swcb_ (1swc B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)

8. Domain d1swcb_: 1swc B: [27318]

Details for d1swcb_

PDB Entry: 1swc, 1.8 Å

PDB Description: apo-core-streptavidin at ph 4.5

PDB Compounds: (B:) streptavidin

SCOP Domain Sequences for d1swcb_:

Sequence; same for both SEQRES and ATOM records:

>d1swcb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk

Timeline for d1swcb_:

• d1swcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1swcb_ appears in SCOP 1.73
  
• d1swcb_ appears in SCOPe 2.01
  
• d1swcb_ appears in the current release, SCOPe 2.08