Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (29 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:273057] [256084] (13 PDB entries) |
Domain d4rd3a2: 4rd3 A:207-320 [273156] Other proteins in same PDB: d4rd3a1, d4rd3a3 automated match to d4m53a2 complexed with gdp, mg, po4 |
PDB Entry: 4rd3 (more details), 1.69 Å
SCOPe Domain Sequences for d4rd3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rd3a2 b.43.3.0 (A:207-320) automated matches {Sulfolobus solfataricus [TaxId: 273057]} rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad
Timeline for d4rd3a2: